General Information

  • ID:  hor001944
  • Uniprot ID:  P63298
  • Protein name:  Secretin
  • Gene name:  SCT
  • Organism:  Sus scrofa (Pig)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0046659 digestive hormone activity
  • GO BP:  GO:0002024 diet induced thermogenesis; GO:0007165 signal transduction; GO:0007420 brain development; GO:0009992 intracellular water homeostasis; GO:0021766 hippocampus development; GO:0031667 response to nutrient levels; GO:0032098 regulation of appetite; GO:0048167 regulation of synaptic plasticity; GO:0050996 positive regulation of lipid catabolic process; GO:0090187 positive regulation of pancreatic juice secretion; GO:0090274 positive regulation of somatostatin secretion; GO:1903640 negative regulation of gastrin-induced gastric acid secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  HSDGTFTSELSRLRDSARLQRLLQGLV
  • Length:  27(33-59)
  • Propeptide:  MATRALLLLLLLPPLLLLAGCAARPAPPRAPRHSDGTFTSELSRLRDSARLQRLLQGLVGKRSQQDPENNTAWTKSGEDRLCQLWSHMPALQAWMPMKPPVDQAWSPWLPPGLRAGALVSEPAIPAAEGSPMPP
  • Signal peptide:  MATRALLLLLLLPPLLLLAGC
  • Modification:  T27 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone involved in different processes, such as regulation of the pH of the duodenal content, food intake and water homeostasis. Exerts its biological effects by binding to secretin receptor (SCTR), a G-protein coupled receptor expressed in the basolater
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P06300-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P06300-F1.pdbhor001944_AF2.pdbhor001944_ESM.pdb

Physical Information

Mass: 352037 Formula: C130H219N43O42
Absent amino acids: CIKMNPWY Common amino acids: L
pI: 10.25 Basic residues: 5
Polar residues: 8 Hydrophobic residues: 9
Hydrophobicity: -46.3 Boman Index: -7818
Half-Life / Aliphatic Index: 3.5 hour Aliphatic Index: 101.11
Instability Index: 6373.7 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  8618828
  • Title:  Two alternative processing pathways for a preprohormone: a bioactive form of secretin.
  • PubMed ID:  5465996
  • Title:  Structure of porcine secretin. The amino acid sequence.
  • PubMed ID:  2395872
  • Title:  Processing of prosecretin: isolation of a secretin precursor from porcine intestine.